I have a data set of enzyme sequences and a target variable to predict.
The process I am doing is transforming sequences into smiles and then get numerical inputs for machine learning models.
Problem is: rdkit fails to transform some of the sequences but not all of them. In this case the transformation was stopped for index = 5 which corresponds to the following sequence: 'PQITLWQRPIVTIKIGGQLIEALLDTGADDTVLEXXNLPGRWKPKXIGGIGGFXKVRQYDQVPIEIXGHKTXSTVLVGPTPVNIIGRNLMTQIGCTLNFPISPIETVPVKLKPGMDGPKXKQWPLTEEKIKALMEICKELEEEGKISKIGPENPYNTPVFAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKRKKSVTVLDVGDAYFSIPLDKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYVDDLYVGSDLEIEQHRTKIKELRQYLWKWGFYTPDXKHQEEPPFHWXGYELHPDKWTVQPIVLPEKESWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRG'
Problem transforming a SEQUENCE into SMILES with RDKit
967 Views Asked by Triki Sadok At
1
There are 1 best solutions below
Related Questions in PYTHON
- How can I change UI language as English
- Does kiwi tcms have an upload limit?
- Where can I find kiwi tcms parameters information about json-rpc?
- Kiwi-Tcms integration quesrtion on jira
- Kiwi-tcms | junit-plugin | Not able to publish test results to Kiwi
- How to add gitlab autentification to kiwitcms?
- Kiwi TCMS junit.xml-plugin export fails with error 'version' not found
- New Kiwi TCMS account, full of data that is not mine
- How to delete a link to a bug from a test execution in Kiwi TCMS
- When clicking `Report bug` during Kiwi TCMS TestExecution no URL for editing is opened
Related Questions in BIOINFORMATICS
- How can I change UI language as English
- Does kiwi tcms have an upload limit?
- Where can I find kiwi tcms parameters information about json-rpc?
- Kiwi-Tcms integration quesrtion on jira
- Kiwi-tcms | junit-plugin | Not able to publish test results to Kiwi
- How to add gitlab autentification to kiwitcms?
- Kiwi TCMS junit.xml-plugin export fails with error 'version' not found
- New Kiwi TCMS account, full of data that is not mine
- How to delete a link to a bug from a test execution in Kiwi TCMS
- When clicking `Report bug` during Kiwi TCMS TestExecution no URL for editing is opened
Related Questions in FINGERPRINT
- How can I change UI language as English
- Does kiwi tcms have an upload limit?
- Where can I find kiwi tcms parameters information about json-rpc?
- Kiwi-Tcms integration quesrtion on jira
- Kiwi-tcms | junit-plugin | Not able to publish test results to Kiwi
- How to add gitlab autentification to kiwitcms?
- Kiwi TCMS junit.xml-plugin export fails with error 'version' not found
- New Kiwi TCMS account, full of data that is not mine
- How to delete a link to a bug from a test execution in Kiwi TCMS
- When clicking `Report bug` during Kiwi TCMS TestExecution no URL for editing is opened
Related Questions in RDKIT
- How can I change UI language as English
- Does kiwi tcms have an upload limit?
- Where can I find kiwi tcms parameters information about json-rpc?
- Kiwi-Tcms integration quesrtion on jira
- Kiwi-tcms | junit-plugin | Not able to publish test results to Kiwi
- How to add gitlab autentification to kiwitcms?
- Kiwi TCMS junit.xml-plugin export fails with error 'version' not found
- New Kiwi TCMS account, full of data that is not mine
- How to delete a link to a bug from a test execution in Kiwi TCMS
- When clicking `Report bug` during Kiwi TCMS TestExecution no URL for editing is opened
Related Questions in CHEMINFORMATICS
- How can I change UI language as English
- Does kiwi tcms have an upload limit?
- Where can I find kiwi tcms parameters information about json-rpc?
- Kiwi-Tcms integration quesrtion on jira
- Kiwi-tcms | junit-plugin | Not able to publish test results to Kiwi
- How to add gitlab autentification to kiwitcms?
- Kiwi TCMS junit.xml-plugin export fails with error 'version' not found
- New Kiwi TCMS account, full of data that is not mine
- How to delete a link to a bug from a test execution in Kiwi TCMS
- When clicking `Report bug` during Kiwi TCMS TestExecution no URL for editing is opened
Trending Questions
- UIImageView Frame Doesn't Reflect Constraints
- Is it possible to use adb commands to click on a view by finding its ID?
- How to create a new web character symbol recognizable by html/javascript?
- Why isn't my CSS3 animation smooth in Google Chrome (but very smooth on other browsers)?
- Heap Gives Page Fault
- Connect ffmpeg to Visual Studio 2008
- Both Object- and ValueAnimator jumps when Duration is set above API LvL 24
- How to avoid default initialization of objects in std::vector?
- second argument of the command line arguments in a format other than char** argv or char* argv[]
- How to improve efficiency of algorithm which generates next lexicographic permutation?
- Navigating to the another actvity app getting crash in android
- How to read the particular message format in android and store in sqlite database?
- Resetting inventory status after order is cancelled
- Efficiently compute powers of X in SSE/AVX
- Insert into an external database using ajax and php : POST 500 (Internal Server Error)
Popular # Hahtags
Popular Questions
- How do I undo the most recent local commits in Git?
- How can I remove a specific item from an array in JavaScript?
- How do I delete a Git branch locally and remotely?
- Find all files containing a specific text (string) on Linux?
- How do I revert a Git repository to a previous commit?
- How do I create an HTML button that acts like a link?
- How do I check out a remote Git branch?
- How do I force "git pull" to overwrite local files?
- How do I list all files of a directory?
- How to check whether a string contains a substring in JavaScript?
- How do I redirect to another webpage?
- How can I iterate over rows in a Pandas DataFrame?
- How do I convert a String to an int in Java?
- Does Python have a string 'contains' substring method?
- How do I check if a string contains a specific word?
Looks like the issue is that you have X in your sequence. This is not an amino acid code but a placeholder for an unknown/atypical amino acid. Seems that RDKit cannot process this case:
When we removed the Xs RDKit parsed the sequence correctly. I am not saying that merely removing these is the correct solution, just highlighting the issue. There is probably a much better method for processing these cases.